Human 15 Lipoxygenase 2 protein fragment
| Name | Human 15 Lipoxygenase 2 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114489 |
| Category | Protein |
| Prices | $420.00 |
| Sizes | 10 µg |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | O15296 |
| Gene | ALOX15B |
| Residue | 181 to 280 |
| Sequence | NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFE HWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQA |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE showing ab114489 at approximately 36.63kDa stained with Coomassie Blue.