Human 5HT1A Receptor protein fragment
| Name | Human 5HT1A Receptor protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab152462 |
| Category | Protein |
| Prices | $402.00 |
| Sizes | 10 µg |
| Applications | WB SDS-PAGE ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P08908 |
| Gene | HTR1A |
| Residue | 1 to 36 |
| Sequence | MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQ |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE analysis of ab152462 stained with Coomassie Blue.