Human 5HT2C Receptor protein fragment
| Name | Human 5HT2C Receptor protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114363 |
| Category | Protein |
| Prices | $420.00 |
| Sizes | 10 µg |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P28335 |
| Gene | HTR2C |
| Residue | 1 to 52 |
| Sequence | MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPD GV |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE showing ab114363 at approximately 31.35kDa stained with Coomassie Blue.