Human Activin A Receptor Type IC protein fragment
| Name | Human Activin A Receptor Type IC protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab153595 |
| Category | Protein |
| Applications | ELISA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | Q8NER5 |
| Gene | ACVR1C |
| Residue | 23 to 112 |
| Sequence | SPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQ VFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPM |
| Supplier Page | Shop |
Product images
ab153595 on a 12.5% SDS-PAGE stained with Coomassie Blue.