Human Activin Receptor Type IIB protein fragment
| Name | Human Activin Receptor Type IIB protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114488 |
| Category | Protein |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | GST tag N-Terminus |
| SwissProt/Accession | Q13705 |
| Gene | ACVR2B |
| Residue | 21 to 120 |
| Sequence | RGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWANSSGTI ELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE showing ab114488 at approximately 36.63kDa stained with Coomassie Blue.