Active human BMP10 full length protein

Name Active human BMP10 full length protein
Supplier Abcam
Catalog ab176078
Category Protein
Prices $113.00, $316.00
Sizes 2 µg, 10 µg
Applications SDS-PAGE HPLC FA
Species Reactivities Human
Nature Recombinant
Source HEK 293 cells
Purity >95% by SDS-PAGE .
Bioactivity Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED 50 for this effect is 4.0-6.0 ng/ml.
Endotoxin < 0.100 Eu/µg
SwissProt/Accession O95393
Gene BMP10
Residue 317 to 424
Sequence NAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTP TKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGM AVSECGCR
Supplier Page Shop