Active human BMPR1B protein fragment
| Name | Active human BMPR1B protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab157348 |
| Category | Protein |
| Prices | $352.00 |
| Sizes | 50 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | > 96 % by SDS-PAGE. ab157348 was lyophilized from 0.22 µm filtered solution. |
| Bioactivity | Measured by its ability to inhibit rhBMP4 induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED 50 for this effect is typically 0.02-0.15 µg/ml in the presence of 30 ng/ml of rhBMP4. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | O00238 |
| Gene | BMPR1B |
| Residue | 14 to 126 |
| Sequence | KKEDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSG LPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPL KNRDFVDGPIHHR |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab157348 stained overnight with Coomassie Blue.