Human Apolipoprotein CIII protein fragment
| Name | Human Apolipoprotein CIII protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab157899 |
| Category | Protein |
| Prices | $402.00 |
| Sizes | 10 µg |
| Applications | ELISA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | P02656 |
| Gene | APOC3 |
| Residue | 21 to 99 |
| Sequence | SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSL KDYWSTVKDKFSEFWDLDPEVRPTSAVAA |
| Supplier Page | Shop |
Product images
ab157899 on a 12.5% SDS-PAGE stained with Coomassie Blue.