Active human CCL14 full length protein

• Supplier: Abcam
• Catalog: ab73836
• Category: Protein
• Prices: $239.00
• Sizes: 10 µg
• Applications: SDS-PAGE
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: > 95 % by SDS-PAGE. ab73836 is purified by proprietary chromatographic techniques. Purity is greater than 97.0% as determined by RP-HPLC and SDS-PAGE.
• Bioactivity: Biological Activity: The Biological activity is calculated by its ability to chemoattract Human monocytes at 5-20 ng/ml.
• SwissProt/Accession: Q16627
• Gene: CCL14
• Sequence: TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRG HSVCTNPSDKWVQDYIKDMKEN.