Active human CD244 protein fragment
| Name | Active human CD244 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab185248 |
| Category | Protein |
| Prices | $735.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized ab185248 at 2 μg/ml (100 μl/well) can bind Human CD48. The EC 50 of Human CD48 is 0.39 μg/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q9BZW8 |
| Gene | CD244 |
| Residue | 22 to 221 |
| Sequence | CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWEN GSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATF QVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLI QTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFR |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab185248 in reducing conditions. Gel stained overnight with Coomassie Blue. DTT-reduced protein migrates as 40-50 kDa due to glycosylation.