Active human CD244 protein fragment
| Name | Active human CD244 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab185251 |
| Category | Protein |
| Prices | $735.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized recombinant Human CD48 at 10 µg/mL (100 µL/well) can bind ab185251 with a linear range of 0.1 - 0.5 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q9BZW8 |
| Gene | CD244 |
| Residue | 22 to 221 |
| Sequence | CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWEN GSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATF QVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLI QTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFR |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab185251 in reducing (Lane 1) and non-reducing (Lane 2) conditions. Gel stained overnight with Coomassie Blue. As a result of glycosylation, DTT-reduced protein migrates as 65-80 kDa and non-reduced protein migrates as 130-160 kDa.