Recombinant Human Phospholamban Protein

Name Recombinant Human Phospholamban Protein
Supplier Novus Biologicals
Catalog H00005350-Q01
Category Protein
Prices $369.00, $529.00
Sizes 10 µg, 25 µg
Applications WB ELISA Array
Species Reactivities Human
Nature Recombinant
Source Wheat Germ
Bioactivity This protein is not active and should not be used for experiments requiring activity.
Gene PLN
Sequence MEKVQYLTRSAIRRASTIEMPQQARQKLQN
Description Phospholamban (Human) GST-Tagged Recombinant Protein Source: Wheat Germ (in vitro) Amino Acid Sequence: MEKVQYLTRSAIRRASTIEMPQQARQKLQN
Supplier Page Shop

Product images