Active human CD33 protein fragment
| Name | Active human CD33 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab174052 |
| Category | Protein |
| Prices | $414.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by the ability of the immobilized protein to support the adhesion of Human red blood cells. The ED 50 for this effect is typically 1.2-4.8 µg/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P20138 |
| Gene | CD33 |
| Residue | 18 to 259 |
| Sequence | DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAII SRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYF FRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSW ACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFA GAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH |
| Supplier Page | Shop |
Product images
The purity of ab174052 was determined by reduced SDS-PAGE and staining overnight with Coomassie Blue. Lane 1: MW markers Lane 2: ab174052 (predicted MW of 53kDa) DTT-reduced ab174052 migrates at 62-85 kDa due to glycosylation