Active human CD40L full length protein
| Name | Active human CD40L full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab173999 |
| Category | Protein |
| Prices | $372.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured in a cell proliferation assay using B cell-enriched peripheral blood mononuclear cells (PBMC) in the presence of rhIL4 . The ED 50 for this effect is typically 0.75-3.2 μg/mL in the presence of 20 ng/mL of rhIL4. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P29965 |
| Gene | CD40LG |
| Residue | 108 to 261 |
| Sequence | ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN GKQLTVKRQGLYYIYAQVTFCSNREASSQAPFIASLCLKSPGRFERILLR AANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFG LLKL |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab1743999 stained overnight with Coomassie Blue. Protein migrates as 17.8 kDa in reduced SDS-PAGE.