Active human CD40L full length protein

Name Active human CD40L full length protein
Supplier Abcam
Catalog ab191775
Category Protein
Prices $192.00
Sizes 50 µg
Applications FA SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE .
Bioactivity The ED 50 was determined by the dose-dependent stimulation of IL-8 production by Human PBMC and was found to be in the range of 5-20 ng/mL.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P29965
Gene CD40LG
Residue 113 to 261
Sequence MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLT VKRQGLYYIYAQVTFCSNREASSQAPFIASLCLKSPGRFERILLRAANTH SSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
Supplier Page Shop