Active human CD40L protein fragment
| Name | Active human CD40L protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab168061 |
| Category | Protein |
| Prices | $761.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | CHO |
| Tag/Conjugation | DDDDK tag N-Terminus |
| Purity | >90% by SDS-PAGE. ab168061 is purified by multi-step chromatography. |
| Bioactivity | ab168061 binds to Human CD40. ab168061 induces B cells activation (as demonstrated by dose-dependent upregulation of CD86). |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | P29965 |
| Gene | CD40LG |
| Residue | 116 to 261 |
| Sequence | GDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKR QGLYYIYAQVTFCSNREASSQAPFIASLCLKSPGRFERILLRAANTHSSA KPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab168061.
B cell lymphocyte activation by ab168061. Method: Peripheral Blood Mononuclear Cells (PBMCs) were incubated at 37°C, 5% CO 2 for 48 hours in 48 well plates (1 x 10 6 cells/well). Each well contained 200µl serum free test media with serially diluted ab168061. After treatment, cells were washed and dual-stained with mouse anti-human CD19–PE and mouse anti-human CD86–APC and analyzed by flow cytometry. The data are presented as the percent of CD19 positive B cells that co-stain as CD86 positive, at each concentration of ab168061.