Active human CD40L protein fragment

Name Active human CD40L protein fragment
Supplier Abcam
Catalog ab179625
Category Protein
Prices $291.00, $1,200.00
Sizes 50 µg, 500 µg
Applications FA SDS-PAGE HPLC
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >= 98 % by SDS-PAGE. Also determined by HPCL and spectroscopy at 280 nm.
Bioactivity The activity is determined by the dose production of IL-8 by human PBMCs and is typically 5-10 ng/mL.
Endotoxin <=1.000 Eu/µg
SwissProt/Accession P29965
Gene CD40LG
Residue 113 to 261
Sequence MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLT VKRQGLYYIYAQVTFCSNREASSQAPFIASLWLKSPGRFERILLRAANTH SSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
Supplier Page Shop