| Name | Active human CD40L protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab51956 |
| Category | Protein |
| Prices | $122.00 |
| Sizes | 10 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 95 % by SDS-PAGE. >98% by SDS-PAGE and HPLC analyses |
| Bioactivity | Biological Activity: Determined by the stimulation of IL-12 induction by human peripheral blood mononuclear cells (PBMC) and the stimulation of IL-8 induction by human PBMC. The expected ED50 for this effect is 5-10 ng/ml.Note: Results may vary with PBMC donors. |
| SwissProt/Accession | P29965 |
| Gene | CD40LG |
| Residue | 113 to 261 |
| Sequence | MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLT VKRQGLYYIYAQVTFCSNREASSQAPFIASLCLKSPGRFERILLRAANTH SSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL |
| Supplier Page | Shop |