Active human CD47 protein fragment
| Name | Active human CD47 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab174029 |
| Category | Protein |
| Prices | $400.00 |
| Sizes | 50 µg |
| Applications | ELISA FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its binding ability in a functional ELISA. When Recombinant Human CD172a / SIRP alpha Fc Chimera is coated at 1 µg/mL, ab174029 binds with apparent KD < 1 nM. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q08722 |
| Gene | CD47 |
| Residue | 19 to 139 |
| Sequence | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTF DGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTE LTREGETIIELKYRVVSWFS P |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab174029 stained overnight with Coomassie Blue. DTT-reduced Protein migrates as 35-43 kDa due to glycosylation.