Recombinant Human NPRA/NPR1 Protein
| Name | Recombinant Human NPRA/NPR1 Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00004881-Q01 |
| Category | Protein |
| Prices | $369.00, $529.00 |
| Sizes | 10 µg, 25 µg |
| Applications | WB ELISA Array |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat Germ |
| Gene | NPR1 |
| Sequence | GVKDEYALTTRAGPSYAKLGDFVAALHRRLGWERQALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICSS |
| Description | NPR-1/Natriuretic Peptide Receptor A (Human) GST-Tagged Recombinant Protein Source: Wheat Germ (in vitro) Amino Acid Sequence: GVKDEYALTTRAGPSYAKLGDFVAALHRRLGWERQALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICSS |
| Supplier Page | Shop |
Product images
![Recombinant Human NPR-1/Natriuretic Peptide Receptor A Protein [H00004881-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.](http://www.bioprodhub.com/system/product_images/pp_products/5/sub_1/20972_Recombinant-Human-NPR-1-Natriuretic-Peptide-Receptor-A-Protein-H00004881-Q01-img0001.jpg)
Recombinant Human NPR-1/Natriuretic Peptide Receptor A Protein [H00004881-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.