Recombinant Human ATG12 Protein

Name Recombinant Human ATG12 Protein
Supplier Novus Biologicals
Catalog H00009140-P01
Category Protein
Prices $369.00, $529.00
Sizes 10 µg, 25 µg
Applications WB ELISA Array
Species Reactivities Human
Nature Recombinant
Source Wheat Germ
Bioactivity This protein is not active and should not be used for experiments requiring activity.
Gene ATG12
Sequence MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIYLCESVLCSFPRPRSWNSL
Description ATG12 (Human) GST-Tagged Recombinant Protein (P01) Source: Wheat Germ (in vitro) Amino Acid Sequence: MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIYLCESVLCSFPRPRSWNSL
Supplier Page Shop

Product images