Recombinant Human Apelin Protein

Name Recombinant Human Apelin Protein
Supplier Novus Biologicals
Catalog H00008862-P02
Category Protein
Prices $250.00
Sizes 2 µg
Applications WB ELISA Array
Species Reactivities Human
Nature Recombinant
Source Wheat Germ
Bioactivity This protein is not active and should not be used for experiments requiring activity.
Gene APLN
Sequence MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Description Apelin (Human) GST-Tagged Recombinant Protein Source: Wheat Germ (in vitro) Amino Acid Sequence: MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.