Recombinant Human NRAMP1/SLC11A1 Protein

Name Recombinant Human NRAMP1/SLC11A1 Protein
Supplier Novus Biologicals
Catalog H00006556-Q01
Category Protein
Prices $369.00, $529.00
Sizes 10 µg, 25 µg
Applications WB ELISA Array
Species Reactivities Human
Nature Recombinant
Source Wheat Germ
Bioactivity This protein is not active and should not be used for experiments requiring activity.
Gene SLC11A1
Sequence QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV
Description NRAMP1/SLC11A1 (Human) GST-Tagged Recombinant Protein Source: Wheat Germ (in vitro) Amino Acid Sequence: QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV
Supplier Page Shop

Product images