| Name | Active human CXCL14 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab138785 |
| Category | Protein |
| Prices | $239.00 |
| Sizes | 10 µg |
| Applications | HPLC SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . Purity is > 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Bioactivity | The ED 50 as determined by its ability to induce calcium flux of prostaglandin E2 treated THP1 human acute monocytic leukemia cells was 1.0-10.0 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | O95715 |
| Gene | CXCL14 |
| Residue | 35 to 111 |
| Sequence | SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHC LHPKLQSTKRFIKWYNAWNEKRRVYE E |
| Supplier Page | Shop |