Active human Cyclophilin F full length protein
| Name | Active human Cyclophilin F full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab79186 |
| Category | Protein |
| Prices | $192.00, $588.00 |
| Sizes | 100 µg, 500 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 95 % by SDS-PAGE. ab79186 is purified using conventional chromatography techniques. Endotoxin Level: < 1.0 EU per 1µg of protein (determined by LAL method) |
| Bioactivity | Specific activity is > 250 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin. Activity Assay Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin. Add 10 µl of recombinant Cyclophilin F (PPIF) protein with 1 µg in assay buffer. Mix by inversion and equilibrate to 1deg;C and monitor the A405nm until the value is constant using a spectrophotometer. Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM) Record the increase in A405 nm for 30 minutes at 25°C. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P30405 |
| Gene | PPIF |
| Sequence | MGSSHHHHHHSSGLVPRGSHCSKGSGDPSSSSSSGNPLVYLDVDANGKPL GRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDF TNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTI KTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS |
| Supplier Page | Shop |
Product images
15% SDS-PAGE showing ab79186 at approximately 21kDa (3µg).