Active human DcR1 full length protein
| Name | Active human DcR1 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab157352 |
| Category | Protein |
| Prices | $410.00 |
| Sizes | 50 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Binds Human and mouse TRAIL. Inhibits Human soluble TRAIL-mediated apoptosis in a concentration range of 50-100ng/ml. |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | O14798 |
| Gene | TNFRSF10C |
| Residue | 25 to 240 |
| Sequence | SATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVD YTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEM CRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGT PAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAA EETMITSPGTPASSHY |
| Supplier Page | Shop |
Product images
Inhibition of TRAIL-mediated lysis. ab157352 exerts its inhibitory activity in a concentration range of 50-100µg/ml. Method: Human Jurkat lymphoma cells (50,000 cells in 100µl DMEM medium containing 5% fetal calf serum) were incubated with 0.1µg/ml soluble TRAIL plus 2µg/ml enhancer and increasing concentrations of ab157352 in a 96-well plate for 16 hours at 37°C. Concentrations of ab157352 required to inhibit may vary depending on the cell type studied and on the concentration of sTRAIL used to kill cells. Cell viability was determined using a MTT-based cell proliferation assay kit.