Human cbx7 protein fragment
| Name | Human cbx7 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab198427 |
| Category | Protein |
| Prices | $837.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >90% by SDS-PAGE. |
| SwissProt/Accession | O95931 |
| Gene | CBX7 |
| Residue | 2 to 90 |
| Sequence | MHHHHHHELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEP EEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLR |
| Supplier Page | Shop |
Product images
4-20% SDS-PAGE analysis of ab198427 with Coomassie staining. Lane 1: 2 µg ab198427 Lane 2: Protein Marker