Human CCL14 full length protein

• Supplier: Abcam
• Catalog: ab151939
• Category: Protein
• Prices: $188.00
• Sizes: 10 µg
• Applications: SDS-PAGE HPLC
• Species Reactivities: Human
• Nature: Recombinant
• Source: HEK 293 cells
• Tag/Conjugation: His tag C-Terminus
• Purity: >95% by SDS-PAGE . ab151939 has purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. 0.2 µM filtered.
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: Q16627
• Gene: CCL14
• Residue: 20 to 93
• Sequence: TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITK RGHSVCTNPSDKWVQDYIKDMKENVDHHHHHH