Name | Human CCL14 full length protein |
---|---|
Supplier | Abcam |
Catalog | ab104678 |
Category | Protein |
Prices | $235.00, $866.00 |
Sizes | 100 µg, 500 µg |
Applications | SDS-PAGE MS |
Species Reactivities | Human |
Nature | Recombinant |
Source | E. coli |
Tag/Conjugation | His tag N-Terminus |
Purity | > 95 % by SDS-PAGE. ab104678 is purified using conventional chromatography techniques, after refolding of the isolated inclusion bodies in a renaturation buffer. |
Endotoxin | < 1.000 Eu/µg |
SwissProt/Accession | Q16627 |
Gene | CCL14 |
Residue | 20 to 93 |
Sequence | MGSSHHHHHHSSGLVPRGSHMTKTESSSRGPYHPSECCFTYTTYKIPRQR IMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
Supplier Page | Shop |