Human CCL14 full length protein

Name Human CCL14 full length protein
Supplier Abcam
Catalog ab104678
Category Protein
Prices $235.00, $866.00
Sizes 100 µg, 500 µg
Applications SDS-PAGE MS
Species Reactivities Human
Nature Recombinant
Source E. coli
Tag/Conjugation His tag N-Terminus
Purity > 95 % by SDS-PAGE. ab104678 is purified using conventional chromatography techniques, after refolding of the isolated inclusion bodies in a renaturation buffer.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession Q16627
Gene CCL14
Residue 20 to 93
Sequence MGSSHHHHHHSSGLVPRGSHMTKTESSSRGPYHPSECCFTYTTYKIPRQR IMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Supplier Page Shop

Product images