Human CCL14 full length protein
| Name | Human CCL14 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab195067 |
| Category | Protein |
| Prices | $176.00 |
| Sizes | 4 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Mammalian |
| Tag/Conjugation | StrepII tag N-Terminus |
| Purity | >95% by SDS-PAGE . Chemically-defined, serum- and animal-product-free culture medium. |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | Q16627 |
| Gene | CCL14 |
| Residue | 20 to 93 |
| Sequence | TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITK RGHSVCTNPSDKWVQDYIKDMKEN |
| Supplier Page | Shop |
Product images
SDS-PAGE of 2 μg ab195067.