Active human Dihydrofolate reductase (DHFR) full length protein
| Name | Active human Dihydrofolate reductase (DHFR) full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab167972 |
| Category | Protein |
| Prices | $352.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Specific activity is 1.5 - 2.5 units/ml and was obtained by measuring the oxidation of NADPH in absorbance at 340 nm during reaction. One unit will convert 1.0 µmole of 7, 8 dihydrofolate and beta-NADPH to 5, 6, 7, 8-tetrahydrofolate and beta-NADP per minute at pH 6.5 at 25°C. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P00374 |
| Gene | DHFR |
| Residue | 1 to 187 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMVGSLNCIVAVSQNMGIGKNGDLPWPPLRN EFRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSREL KEPPQGAHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPG HLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKF EVYEKND |
| Supplier Page | Shop |
Product images
15% SDS PAGE analysis of ab167972 (3µg).