Human CD163 protein fragment
| Name | Human CD163 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112384 |
| Category | Protein |
| Prices | $402.00 |
| Sizes | 10 µg |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | Useful for Antibody Production and Protein Array |
| SwissProt/Accession | Q86VB7 |
| Gene | CD163 |
| Residue | 78 to 168 |
| Sequence | NGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESAL WDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMC |
| Supplier Page | Shop |
Product images
ab112384 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.