Recombinant Human IRF1 Protein
| Name | Recombinant Human IRF1 Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBC1-18471 |
| Category | Protein |
| Prices | $269.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Purity | >90%, by SDS-PAGE |
| Endotoxin | < 1.0 EU per 1 microgram of protein (determined by LAL method) |
| Gene | IRF1 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPP |
| Description | A recombinant protein corresponding to amino acids 1 - 114 of IRF1 |
| Supplier Page | Shop |
Product images
![SDS-Page: IRF1 Protein [NBC1-18471] - IRF1, 15 kDa (134 aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE](http://www.bioprodhub.com/system/product_images/pp_products/5/sub_1/29368_IRF1%2520Protein-SDS-Page-NBC1-18471-img0001.jpg)
SDS-Page: IRF1 Protein [NBC1-18471] - IRF1, 15 kDa (134 aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE