Active human DR5 protein fragment
| Name | Active human DR5 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab157268 |
| Category | Protein |
| Prices | $465.00 |
| Sizes | 50 µg |
| Applications | ELISA FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Binds Human and mouse TRAIL. Inhibits Human soluble TRAIL-induced apoptosis in a concentration range of 0.5-10µg/ml. |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | O14763 |
| Gene | TNFRSF10B |
| Residue | 52 to 212 |
| Sequence | ESALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQ DYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPE MCRKCRTGCPRGMVKVGDCTPWSDIECVHKESGTKHSGEVPAVEETVTSS PGTPASPCSLS |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab157268. Lane 1:1 µg, Lane 2: 2 µg.
ELISA analysis: 100 ng/well of receptor or control is coated on a 96-well plate. After blocking, ligand is titrated 2-fold in series, and detected with anti-flag antibody. TRAIL shows positive for binding to ab157268 (TRAIL-R2) and negative for binding to either Fc control protein and buffer control.