Active human EDA2R protein fragment
| Name | Active human EDA2R protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab191641 |
| Category | Protein |
| Prices | $515.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized ab191641 at 0.1 µg/ml (100 µl/well), the concentration of Recombinant Human EDA-A2/Ectodysplasin A2 that produces 50% of the optimal binding response is typically 4-16 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q9HAV5 |
| Gene | EDA2R |
| Residue | 1 to 138 |
| Sequence | MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYK SSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQ DQECIPCTKQTPTSEVQCAFQLSLVEADAPTVPPQEAT |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab191641 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 50-55 kDa due to glycosylation.