Active human EGF full length protein
| Name | Active human EGF full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab9697 |
| Category | Protein |
| Prices | $257.00 |
| Sizes | 500 µg |
| Applications | WB FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Bioactivity | active |
| Endotoxin | < 0.010 Eu/µg |
| SwissProt/Accession | P01133 |
| Gene | EGF |
| Sequence | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW ELR |
| Supplier Page | Shop |
Product images
Lane 1 : Lane 2 : Lane 3 : Lane 1 : Whole cell lysate of human skin fibroblasts starved overnight in serum-free medium Lane 2 : Whole cell lysate of human skin fibroblasts starved overnight in serum-free medium and then incubated for 30 min with 25 ng/ml active EGF Lane 3 : Whole cell lysate of human skin fibroblasts starved overnight in serum-free medium and then incubated for 30 min with 50 ng/ml active EGF Lysates/proteins at 20 µg per lane. Secondary An HRP-conjugatede Goat anti-rabbit IgG polyclonal at 1/10000 dilution developed using the ECL technique Performed under non-reducing conditions. Observed band size : 42,44 kDa ( why is the actual band size different from the predicted? ) Exposure time : 1 second This image is courtesy of an anonymous Abreview See Abreview
Product References
EMT and EGFR in CTCs cytokeratin negative non-metastatic breast cancer. - EMT and EGFR in CTCs cytokeratin negative non-metastatic breast cancer.
Serrano MJ, Ortega FG, Alvarez-Cubero MJ, Nadal R, Sanchez-Rovira P, Salido M, Rodriguez M, Garcia-Puche JL, Delgado-Rodriguez M, Sole F, Garcia MA, Peran M, Rosell R, Marchal JA, Lorente JA. Oncotarget. 2014 Sep 15;5(17):7486-97.
Improvement of an antibody-enzyme coupling yield by enzyme surface supercharging. - Improvement of an antibody-enzyme coupling yield by enzyme surface supercharging.
Prasse AA, Zauner T, Buttner K, Hoffmann R, Zuchner T. BMC Biotechnol. 2014 Oct 18;14:88.