Active human EGF full length protein
| Name | Active human EGF full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab168895 |
| Category | Protein |
| Prices | $410.00 |
| Sizes | 1 mg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 97 % by SDS-PAGE. |
| Bioactivity | Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblasts. The ED 50 for this effect is typically 20-100 pg/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P01133 |
| Gene | EGF |
| Residue | 971 to 1023 |
| Sequence | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW ELR |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab168895 stained overnight with Coomassie Blue.