Recombinant Human CCL13/MCP-4 Protein

• Supplier: Novus Biologicals
• Catalog: NBP1-48346
• Category: Protein
• Prices: $269.00, $729.00
• Sizes: 10 µg, 50 µg
• Applications: SDS-PAGE
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: >90%, by SDS-PAGE
• Endotoxin: < 1.0 EU per 1 microgram of protein (determined by LAL method)
• Gene: CCL13
• Sequence: MGSSHHHHHHSSGLVPRGSHMQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
• Description: A recombinant protein with a His tag and corresponding to amino acids 24 - 98 of CCL13