Recombinant Human Methionine Sulfoxide Reductase B Protein

• Supplier: Novus Biologicals
• Catalog: NBP1-49302
• Category: Protein
• Prices: $269.00, $729.00
• Sizes: 50 µg, 250 µg
• Applications: SDS-PAGE
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: >90%, by SDS-PAGE
• Gene: MSRB1
• Sequence: MGSSHHHHHHSSGLVPRGSHMSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRFCIFSSSLKFVPKGKETSASQGH
• Description: A recombinant protein with a His tag and corresponding to amino acids 1 - 116 of MSRB1