Active human EpCAM protein fragment
| Name | Active human EpCAM protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab155712 |
| Category | Protein |
| Prices | $352.00 |
| Sizes | 100 µg |
| Applications | ELISA FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | > 98 % by SDS-PAGE. |
| Bioactivity | Measured by the ability of the immobilized protein to support the adhesion of the L Cells mouse fibroblast cell line. When 5×10 4 cells/well are added to ab155712 and Human Fibronectin 0.5 µg/ml coated plates, cell adhesion is enhanced in a dose dependent manner after 45 minutes at 37°C. The ED 50 for this effect is typically 0.5-2.9 µg/mL. Measured by its binding ability in a functional ELISA. The activity of this protein is measured in a homophilic binding assay. Please kindly note that this reconstitution instruction below MUST be followed to ensure successful reconstitution, and any improper handling will lead to loss or destroy of the activity. Avoid vigorous shaking or vortexing. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P16422 |
| Gene | EPCAM |
| Residue | 24 to 265 |
| Sequence | QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEM NGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAG VRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTR YQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGE SLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK |
| Supplier Page | Shop |
Product images
SDS-PAGE of reduced ab155712 stained overnight with Coomassie Blue.