| Name | CRSP-1 |
|---|---|
| Supplier | R&D Systems |
| Catalog | 3555 |
| Category | Peptide |
| Prices | $219.00 |
| Sizes | 100 µg |
| Gene | MED1 |
| Sequence | SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG (Modifications: Disulfide bridge between 2 - 7, Gly-38 = C-terminal amide) |
| Description | Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry |
| Supplier Page | Shop |