Biogenesis of lysosome-related organelles complex 1 subunit 1 protein

Name Biogenesis of lysosome-related organelles complex 1 subunit 1 protein
Supplier Biomatik
Catalog RPC140215
Category Protein
Prices $299.20, $352.00, $550.00, $687.50, $997.50, $1,507.50
Sizes 10 µg, 50 µg, 100 µg, 200 µg, 500 µg, 1 mg
Species Reactivities Human
Nature Recombinant
Source E.coli
Tag/Conjugation GST tag
Gene BLOC1S1
Sequence MAPGSRGERSSFRSRRGPGVPSPQPDVTMLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS-
Supplier Page Shop