| Name | Rab1A Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33367 |
| Category | Protein |
| Prices | $489.00 |
| Sizes | 50 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Synthetic |
| Purity | Protein |
| Gene | RAB1A |
| Description | Synthetic peptides corresponding to RAB1A(RAB1A, member RAS oncogene family) The peptide sequence was selected from the middle region of RAB1A. Peptide sequence AKNATNVEQSFMTMAAEIKKRMGPGATAGG AEKSNVKIQSTPVKQSGGGC. |
| Supplier Page | Shop |