Active human Estrogen Inducible Protein pS2 full length protein

• Supplier: Abcam
• Catalog: ab201359
• Category: Protein
• Prices: $101.00
• Sizes: 5 µg
• Applications: HPLC SDS-PAGE FA
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: > 97 % by SDS-PAGE. > 97 % by HPLC analysis.
• Bioactivity: Fully biologically active when compared to standard. Determined by its ability to activate ERK1/2 (a MAPkinase signaling molecule) using a concentration 1.0-2.0 μg/ml.
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: P04155
• Gene: TFF1
• Residue: 25 to 84
• Sequence: EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTI DVPPEEECEF