Active human FKBP6 full length protein

Name Active human FKBP6 full length protein
Supplier Abcam
Catalog ab95497
Category Protein
Prices $232.00, $883.00
Sizes 50 µg, 250 µg
Applications SDS-PAGE MS FA
Species Reactivities Human
Nature Recombinant
Source E. coli
Tag/Conjugation His tag N-Terminus
Purity > 95 % by SDS-PAGE. ab95497 is purified using conventional chromatography techniques.
Bioactivity Specific activity is > 190 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin. Activity Assay Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin. Add 10 µl of recombinant FKBP6 protein with 1 µg in assay buffer. Mix by inversion and equilibrate to 1°C and monitor the A405nm until the value is constant using a spectrophotometer. Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM) Record the increase in A405 nm for 30 minutes at 25°C.
SwissProt/Accession O75344
Gene FKBP6
Sequence MGSSHHHHHHSSGLVPRGSH MGGSALNQGVLEGDDAPGQSLYERLSQRML DISGDRGVLKDVIREGAGDLVAPDASVLVKYSGYLEHMDRPFDSNYFRKT PRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPN TTVLFEIELLDFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNY LFRQNRFYDAKVRYKRALLLLRRRSAPPEEQHLVEAAKLPVLLNLSFTYL KLDRPTIALCYGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQ KEQPFNHDINNELKKLASCYRDYVDKEKEMWHRMFAPCGDGSTAGES
Supplier Page Shop

Product images