Human Deformed Epidermal Autoregulatory Factor 1 protein fragment
| Name | Human Deformed Epidermal Autoregulatory Factor 1 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab161033 |
| Category | Protein |
| Applications | ELISA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | O75398 |
| Gene | DEAF1 |
| Residue | 466 to 564 |
| Sequence | TAQQLKTLFEQAKHASTYREAATNQAKIHADAERKEQSCVNCGREAMSEC TGCHKVNYCSTFCQRKDWKDHQHICGQSAAVTVQADEVHVAESVMEKVT |
| Supplier Page | Shop |
Product images
ab161033 on a 12.5% SDS-PAGE stained with Coomassie Blue.