CCRL2/CRAM-A/B Recombinant Protein Antigen

Name CCRL2/CRAM-A/B Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-85588PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CCRL2/CRAM-A/B Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CCRL2
Sequence FLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCRL2
Supplier Page Shop